PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.J00810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 195aa    MW: 21411.4 Da    PI: 7.3446
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.J00810.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF34.42.8e-111149342
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    ien  +   t+ +Rr g+ KK + L +LC++e+++i f +
  Pahal.J00810.1 11 IENPKR-RATYKNRRDGLVKKTSQLATLCGVEALLICFDP 49
                    677655.579**************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-9164IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.358147IPR002100Transcription factor, MADS-box
CDDcd001202.76E-16350No hitNo description
SuperFamilySSF554552.09E-14388IPR002100Transcription factor, MADS-box
PfamPF003192.6E-121250IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MPRGKLGMKL IENPKRRATY KNRRDGLVKK TSQLATLCGV EALLICFDPK PADGGGASAV  60
TTWPADREDV LELIKKYRET PEDKVRHSFT AAAYYQEELA KQQRKLRKIE QCGPDKLNLQ  120
DWRLADLSPG DLGALLVTLD ETLRKAQQRI VALGGHVEDD GDVPSATTAM VAAPTPLADY  180
NSFDLAFSVP DAGSM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4AK503e-92K4AK50_SETIT; Uncharacterized protein
STRINGSi039273m9e-92(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143511825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.18e-15M-type_MADS family protein